PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10024183
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 226aa    MW: 24261.5 Da    PI: 8.9743
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10024183genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.61.6e-41221211100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++pe++r da++slvyeA+ r+rdPvyG++g i++lqqq+++l++el+ ++
  Lus10024183  22 PCAACKLLRRRCAEECPFSPYFSPHEPHKFAAVHKVFGASNVSKMLLEVPESQRADAANSLVYEANLRLRDPVYGCMGAISALQQQIQSLQSELNGVR 119
                  7*********************************************************************************************9988 PP

       DUF260  99 ee 100
                  +e
  Lus10024183 120 SE 121
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.79421122IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-4122118IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MGMRSIVMNM ISPPGVLNTV TPCAACKLLR RRCAEECPFS PYFSPHEPHK FAAVHKVFGA  60
SNVSKMLLEV PESQRADAAN SLVYEANLRL RDPVYGCMGA ISALQQQIQS LQSELNGVRS  120
EILKYKYREA TTSLLSSAAH ASLISSGVVS VIAPTTPVVV GPNQHRHHQP QPPRTPTPAP  180
PPPQPSIVIS SSSSSTNASN NNNNTNNLYS SITASDRHSG VPYFD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY7955612e-68AY795561.1 Triticum aestivum LOB1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012091188.11e-83PREDICTED: LOB domain-containing protein 15
SwissprotQ9AT614e-76LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A067JNV91e-83A0A067JNV9_JATCU; Uncharacterized protein
STRINGVIT_13s0067g02380.t014e-81(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-67LOB domain-containing protein 15